Rabbit anti-Human CD134/OX40 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04089P

• Product Name:
• Rabbit anti-Human CD134/OX40 Polyclonal Antibody

• Synonym:
• OX40; ACT35; CD134; IMD16; TXGP1L; CD134/OX40

• Description:
• The antibody against CD134/OX40 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD134/OX40 (NP_003318.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD134/OX40 (NP_003318.1).

• Species Reactivity:
• Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD134/OX40

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQ

• Gene ID:
• 7293

• Uniprot-ID:
• P43489

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat liver