Rabbit anti-Human CD127/IL7R Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02295P

• Product Name:
• Rabbit anti-Human CD127/IL7R Polyclonal Antibody

• Synonym:
• ILRA; CD127; IL7RA; CDW127; IMD104; sIL-7R; lnc-IL7R; IL7Ralpha; IL-7Ralpha; IL-7R-alpha; CD127/IL7R

• Description:
• The antibody against CD127/IL7R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-239 of human CD127/IL7R (NP_002176.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 21-239 of human CD127/IL7R (NP_002176.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD127/IL7R

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMD

• Gene ID:
• 3575

• Uniprot-ID:
• P16871

• Purification Method:
• Affinity purification

• Positive Samples:
• Raji, Mouse thymus