Rabbit anti-Human CD121a Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08019P

• Product Name:
• Rabbit anti-Human CD121a Polyclonal Antibody

• Synonym:
• P80; IL1R; IL1RA; CD121A; D2S1473; IL-1RT1; IL-1R-alpha; CD121a

• Description:
• The antibody against CD121a was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-332 of human CD121a. (NP_000868.1?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 21-332 of human CD121a. (NP_000868.1?).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD121a

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT

• Gene ID:
• 3554

• Uniprot-ID:
• P14778

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Raji, NIH/3T3, Rat liver