Rabbit anti-Human CCT6A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08120P

• Product Name:
• Rabbit anti-Human CCT6A Polyclonal Antibody

• Synonym:
• CCT6; Cctz; HTR3; TCPZ; TCP20; MoDP-2; TTCP20; CCT-zeta; CCT-zeta-1; TCP-1-zeta

• Description:
• The antibody against CCT6A was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids80-250 of human CCT6A(NP_001753.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids80-250 of human CCT6A(NP_001753.1).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CCT6A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFEAAKEKALQFLEEVKVSREMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIKKQDEPIDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVEDAYILTCNVSLEYEKTEVNSGFFY

• Gene ID:
• 908

• Uniprot-ID:
• P40227

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Rat brain