Rabbit anti-Human CCT3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11800P

• Product Name:
• Rabbit anti-Human CCT3 Polyclonal Antibody

• Synonym:
• CCTG; PIG48; TRIC5; CCT-gamma; TCP-1-gamma; CCT3

• Description:
• The antibody against CCT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human CCT3 (NP_005989.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human CCT3 (NP_005989.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CCT3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLA

• Gene ID:
• 7203

• Uniprot-ID:
• P49368

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, 293T, HepG2, Mouse brain, Mouse heart, Mouse kidney, Mouse liver