Rabbit anti-Human CCR9 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11920P

• Product Name:
• Rabbit anti-Human CCR9 Polyclonal Antibody

• Synonym:
• GPR28; CDw199; GPR-9-6; CC-CKR-9; CCR9

• Description:
• The antibody against CCR9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-369 of human CCR9 (NP_112477.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 300-369 of human CCR9 (NP_112477.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CCR9

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL

• Gene ID:
• 10803

• Uniprot-ID:
• P51686

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain