Rabbit anti-Human CCR6 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04567P

• Product Name:
• Rabbit anti-Human CCR6 Polyclonal Antibody

• Synonym:
• BN-1; DCR2; DRY6; CCR-6; CD196; CKRL3; GPR29; CKR-L3; CMKBR6; GPRCY4; STRL22; CC-CKR-6; C-C CKR-6; CCR6

• Description:
• The antibody against CCR6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human CCR6 (NP_004358.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human CCR6 (NP_004358.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CCR6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VTEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQTSETADNDNASSFTM

• Gene ID:
• 1235

• Uniprot-ID:
• P51684

• Purification Method:
• Affinity purification

• Positive Samples:
• LO2