Rabbit anti-Human CCR5 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08482P

• Product Name:
• Rabbit anti-Human CCR5 Polyclonal Antibody

• Synonym:
• CKR5; CCR-5; CD195; CKR-5; CCCKR5; CMKBR5; IDDM22; CC-CKR-5; CCR5

• Description:
• The antibody against CCR5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR5 (NP_000570.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR5 (NP_000570.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CCR5

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTM

• Gene ID:
• 1234

• Uniprot-ID:
• P51681

• Purification Method:
• Affinity purification