Rabbit anti-Human CCR3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04057P

• Product Name:
• Rabbit anti-Human CCR3 Polyclonal Antibody

• Synonym:
• CKR3; CD193; CKR 3; CMKBR3; C C CKR3; CC-CKR-3; CCR3

• Description:
• The antibody against CCR3 was raised in Rabbit using the recombinant fusion protein containing a sequence within amino acids 146-226 of human CCR3 (NP_001828.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence within amino acids 146-226 of human CCR3 (NP_001828.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CCR3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TVTFGVITSIVTWGLAVLAALPEFIFYETEELFEETLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTL

• Gene ID:
• 1232

• Uniprot-ID:
• P51677

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, A-549, Raji, Mouse liver, Rat spleen