Rabbit anti-Human CCL16 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05145P

• Product Name:
• Rabbit anti-Human CCL16 Polyclonal Antibody

• Synonym:
• LEC; LMC; NCC4; CKb12; HCC-4; LCC-1; Mtn-1; NCC-4; SCYL4; ILINCK; SCYA16; CCL16

• Description:
• The antibody against CCL16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CCL16 (NP_004581.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CCL16 (NP_004581.1).

• Species Reactivity:
• Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CCL16

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

• Gene ID:
• 6360

• Uniprot-ID:
• O15467

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat liver