Rabbit anti-Human CCDC6 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07808P

• Product Name:
• Rabbit anti-Human CCDC6 Polyclonal Antibody

• Synonym:
• H4; PTC; TPC; PTC1; TST1; D10S170; CCDC6

• Description:
• The antibody against CCDC6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 55-222 of human CCDC6 (NP_005427.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 55-222 of human CCDC6 (NP_005427.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CCDC6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RLEELTNRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMD

• Gene ID:
• 8030

• Uniprot-ID:
• Q16204

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, HeLa, Jurkat, Mouse brain