Rabbit anti-Human CC2D1A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03894P

• Product Name:
• Rabbit anti-Human CC2D1A Polyclonal Antibody

• Synonym:
• Lgd2; MRT3; TAPE; Aki-1; FREUD-1; Freud-1/Aki1; CC2D1A

• Description:
• The antibody against CC2D1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CC2D1A (NP_060191.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CC2D1A (NP_060191.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CC2D1A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPMEAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTLQERLALYQTA

• Gene ID:
• 54862

• Uniprot-ID:
• Q6P1N0

• Purification Method:
• Affinity purification

• Positive Samples:
• U-251MG, SKOV3, 293T, A-549, LO2, Mouse brain, Rat brain