Rabbit anti-Human CBX7 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08358P

• Product Name:
• Rabbit anti-Human CBX7 Polyclonal Antibody

• Synonym:
• CBX7

• Description:
• The antibody against CBX7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 162-251 of human CBX7(NP_783640.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 162-251 of human CBX7(NP_783640.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CBX7

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF

• Gene ID:
• 23492

• Uniprot-ID:
• O95931

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, U-251 MG, Jurkat