Rabbit anti-Human CBX1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00522P

• Product Name:
• Rabbit anti-Human CBX1 Polyclonal Antibody

• Synonym:
• CBX; M31; MOD1; p25beta; HP1-BETA; HP1Hsbeta; HP1Hs-beta; CBX1

• Description:
• The antibody against CBX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HP1 beta/CBX1 (NP_006798.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HP1 beta/CBX1 (NP_006798.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CBX1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKP

• Gene ID:
• 10951

• Uniprot-ID:
• P83916

• Purification Method:
• Affinity purification

• Positive Samples:
• OVCAR3