Rabbit anti-Human Caspase-7 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12840P

• Product Name:
• Rabbit anti-Human Caspase-7 Polyclonal Antibody

• Synonym:
• MCH3; CMH-1; LICE2; CASP-7; ICE-LAP3; Caspase-7

• Description:
• The antibody against Caspase-7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human Caspase-7 (NP_001218.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Caspase-7 (NP_001218.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Caspase-7

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILE

• Gene ID:
• 840

• Uniprot-ID:
• P55210

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse liver, Rat liver