Rabbit anti-Human Caspase-7 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06504P

• Product Name:
• Rabbit anti-Human Caspase-7 Polyclonal Antibody

• Synonym:
• MCH3; CMH-1; LICE2; CASP-7; ICE-LAP3; Caspase-7

• Description:
• The antibody against Caspase-7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-303 of human Caspase-7 (NP_001218.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 24-303 of human Caspase-7 (NP_001218.1).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• IHC-P, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Caspase-7

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ

• Gene ID:
• 840

• Uniprot-ID:
• P55210

• Purification Method:
• Affinity purification