Rabbit anti-Human CAMP Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06878P

• Product Name:
• Rabbit anti-Human CAMP Polyclonal Antibody

• Synonym:
• LL37; CAP18; CRAMP; HSD26; CAP-18; FALL39; FALL-39; CAMP

• Description:
• The antibody against CAMP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-170 of human CAMP (NP_004336.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 100-170 of human CAMP (NP_004336.4).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CAMP

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

• Gene ID:
• 820

• Uniprot-ID:
• P49913

• Purification Method:
• Affinity purification