Rabbit anti-Human CADM1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11326P

• Product Name:
• Rabbit anti-Human CADM1 Polyclonal Antibody

• Synonym:
• BL2; ST17; IGSF4; NECL2; RA175; TSLC1; IGSF4A; Necl-2; SYNCAM; sgIGSF; sTSLC-1; synCAM1; CADM1

• Description:
• The antibody against CADM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 45-344 of human CADM1 (NP_055148.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 45-344 of human CADM1 (NP_055148.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CADM1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTT

• Gene ID:
• 23705

• Uniprot-ID:
• Q9BY67

• Purification Method:
• Affinity purification

• Positive Samples:
• Human plasma, Mouse lung, Rat lung