Rabbit anti-Human c-Myc Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-13090P

• Product Name:
• Rabbit anti-Human c-Myc Polyclonal Antibody

• Synonym:
• MRTL; MYCC; c-Myc; bHLHe39

• Description:
• The antibody against c-Myc was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 347-439 of human c-Myc (NP_001341799.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 347-439 of human c-Myc (NP_001341799.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• c-Myc

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRRE

• Gene ID:
• 4609

• Uniprot-ID:
• P01106

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa