Rabbit anti-Human c-Myc Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10960P

• Product Name:
• Rabbit anti-Human c-Myc Polyclonal Antibody

• Synonym:
• MRTL; MYCC; c-Myc; bHLHe39

• Description:
• The antibody against c-Myc was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 354-453 of human c-Myc (NP_001341799.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 354-453 of human c-Myc (NP_001341799.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• c-Myc

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA

• Gene ID:
• 4609

• Uniprot-ID:
• P01106

• Purification Method:
• Affinity purification