Rabbit anti-Human C5/C5a Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10754P

• Product Name:
• Rabbit anti-Human C5/C5a Polyclonal Antibody

• Synonym:
• C5D; C5a; C5b; ECLZB; CPAMD4; C5/C5a

• Description:
• The antibody against C5/C5a was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1567-1676 of human C5/C5a (NP_001726.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1567-1676 of human C5/C5a (NP_001726.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• C5/C5a

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC

• Gene ID:
• 727

• Uniprot-ID:
• P01031

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse lung