Rabbit anti-Human C4c Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07961P

• Product Name:
• Rabbit anti-Human C4c Polyclonal Antibody

• Synonym:
• CH; C4F; CO4; C4B1; C4B2; C4B3; C4B5; C4BD; C4B12; C4B_2; CPAMD3; C4c

• Description:
• The antibody against C4c was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1337-1446 of human C4c (NP_001002029.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1337-1446 of human C4c (NP_001002029.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• C4c

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEG

• Gene ID:
• 721

• Uniprot-ID:
• P0C0L5

• Purification Method:
• Affinity purification

• Positive Samples:
• Hep G2, Mouse liver, Mouse spleen, Rat liver, Rat thymus