Rabbit anti-Human C3c Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08165P

• Product Name:
• Rabbit anti-Human C3c Polyclonal Antibody

• Synonym:
• ASP; C3a; C3b; AHUS5; ARMD9; CPAMD1; HEL-S-62p; C3c

• Description:
• The antibody against C3c was raised in Rabbit using the recombinant protein of human C3c as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant protein of human C3c.

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• C3c

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQL

• Gene ID:
• 718

• Uniprot-ID:
• P01024

• Purification Method:
• Affinity purification

• Positive Samples:
• Hep G2