Rabbit anti-Human C1GALT1C1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02414P

• Product Name:
• Rabbit anti-Human C1GALT1C1 Polyclonal Antibody

• Synonym:
• TNPS; COSMC; MST143; C1GALT2; HSPC067; C38H2-L1; C1GALT1C1

• Description:
• The antibody against C1GALT1C1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-190 of human C1GALT1C1 (NP_689905.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 30-190 of human C1GALT1C1 (NP_689905.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• C1GALT1C1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IGHGNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLS

• Gene ID:
• 29071

• Uniprot-ID:
• Q96EU7

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Mouse liver, Mouse kidney