Rabbit anti-Human C14orf166 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04120P

• Product Name:
• Rabbit anti-Human C14orf166 Polyclonal Antibody

• Synonym:
• CLE; CLE7; hCLE; CGI99; RLLM1; hCLE1; CGI-99; LCRP369; C14orf166

• Description:
• The antibody against C14orf166 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-244 of human C14orf166 (NP_057123.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-244 of human C14orf166 (NP_057123.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• C14orf166

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR

• Gene ID:
• 51637

• Uniprot-ID:
• Q9Y224

• Purification Method:
• Affinity purification

• Positive Samples:
• Jurkat, 293T, NIH/3T3