Rabbit anti-Human BRG1/SMARCA4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-13180P

• Product Name:
• Rabbit anti-Human BRG1/SMARCA4 Polyclonal Antibody

• Synonym:
• BRG1; CSS4; SNF2; SWI2; MRD16; RTPS2; BAF190; SNF2L4; SNF2LB; hSNF2b; BAF190A; SNF2-beta; A4

• Description:
• The antibody against BRG1/SMARCA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 30-130 of human BRG1/BRG1/SMARCA4 (NP_003063.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 30-130 of human BRG1/BRG1/SMARCA4 (NP_003063.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• BRG1/SMARCA4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHA

• Gene ID:
• 6597

• Uniprot-ID:
• P51532

• Purification Method:
• Affinity purification

• Positive Samples:
• OVCAR3, HeLa