Rabbit anti-Human BRD2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08710P

• Product Name:
• Rabbit anti-Human BRD2 Polyclonal Antibody

• Synonym:
• FSH; NAT; RNF3; FSRG1; RING3; FSHRG1; D6S113E; O27.1.1; BRD2-IT1; BRD2

• Description:
• The antibody against BRD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 301-400 of human BRD2 (NP_005095.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 301-400 of human BRD2 (NP_005095.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• BRD2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVK

• Gene ID:
• 6046

• Uniprot-ID:
• P25440

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Mouse brain