Rabbit anti-Human BRD2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07233P

• Product Name:
• Rabbit anti-Human BRD2 Polyclonal Antibody

• Synonym:
• FSH; NAT; RNF3; FSRG1; RING3; FSHRG1; D6S113E; O27.1.1; BRD2-IT1; BRD2

• Description:
• The antibody against BRD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human BRD2 (NP_005095.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human BRD2 (NP_005095.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• BRD2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPANPPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFR

• Gene ID:
• 6046

• Uniprot-ID:
• P25440

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, PC-3