Rabbit anti-Human BRCC3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09157P

• Product Name:
• Rabbit anti-Human BRCC3 Polyclonal Antibody

• Synonym:
• C6.1A; BRCC36; CXorf53; BRCC3

• Description:
• The antibody against BRCC3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-316 of human BRCC3 (NP_077308.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-316 of human BRCC3 (NP_077308.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• BRCC3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE

• Gene ID:
• 79184

• Uniprot-ID:
• P46736

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, MCF7, Jurkat, 293T, Mouse liver, Mouse kidney, Mouse brain, Rat liver