Rabbit anti-Human Bim Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09373P

• Product Name:
• Rabbit anti-Human Bim Polyclonal Antibody

• Synonym:
• BAM; BIM; BOD; Bim

• Description:
• The antibody against Bim was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human Bim (NP_619527.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human Bim (NP_619527.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Bim

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSA

• Gene ID:
• 10018

• Uniprot-ID:
• O43521

• Purification Method:
• Affinity purification