Rabbit anti-Human Bcl-W Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01971P

• Product Name:
• Rabbit anti-Human Bcl-W Polyclonal Antibody

• Synonym:
• BCLW; BCL-W; PPP1R51; BCL2-L-2; Bcl-W

• Description:
• The antibody against Bcl-W was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-193 of human Bcl-W (NP_004041.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-193 of human Bcl-W (NP_004041.2).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Bcl-W

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK

• Gene ID:
• 599

• Uniprot-ID:
• Q92843

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain, Rat brain, Rat kidney