Rabbit anti-Human BCAP29 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03080P

• Product Name:
• Rabbit anti-Human BCAP29 Polyclonal Antibody

• Synonym:
• B29; BAP29; BCAP29

• Description:
• The antibody against BCAP29 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 125-241 of human BCAP29 (NP_061332.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 125-241 of human BCAP29 (NP_061332.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• BCAP29

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL

• Gene ID:
• 55973

• Uniprot-ID:
• Q9UHQ4

• Purification Method:
• Affinity purification

• Positive Samples:
• SW480, SKOV3, MCF7, THP-1, ES-2, Mouse testis, Mouse heart, Mouse brain, Rat heart