Rabbit anti-Human B3GALTL Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01062P

• Product Name:
• Rabbit anti-Human B3GALTL Polyclonal Antibody

• Synonym:
• B3GTL; Gal-T; B3GALTL; B3Glc-T; beta3Glc-T

• Description:
• The antibody against B3GALTL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 259-498 of human B3GALTL (NP_919299.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 259-498 of human B3GALTL (NP_919299.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• B3GALTL

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LCRKPVKKKDIFVAVKTCKKFHGDRIPIVKQTWESQASLIEYYSDYTENSIPTVDLGIPNTDRGHCGKTFAILERFLNRSQDKTAWLVIVDDDTLISISRLQHLLSCYDSGEPVFLGERYGYGLGTGGYSYITGGGGMVFSREAVRRLLASKCRCYSNDAPDDMVLGMCFSGLGIPVTHSPLFHQARPVDYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREEL

• Gene ID:
• 145173

• Uniprot-ID:
• Q6Y288

• Purification Method:
• Affinity purification

• Positive Samples:
• U-251MG, HeLa, SKOV3, HepG2, MCF7