Rabbit anti-Human AURKC Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04169P

• Product Name:
• Rabbit anti-Human AURKC Polyclonal Antibody

• Synonym:
• AIE2; AIK3; ARK3; AurC; SPGF5; STK13; HEL-S-90; aurora-C; AURKC

• Description:
• The antibody against AURKC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human AURKC (NP_001015878.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AURKC (NP_001015878.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• AURKC

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQH

• Gene ID:
• 6795

• Uniprot-ID:
• Q9UQB9

• Purification Method:
• Affinity purification

• Positive Samples:
• U-251MG