Rabbit anti-Human ATP6V1A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05498P

• Product Name:
• Rabbit anti-Human ATP6V1A Polyclonal Antibody

• Synonym:
• HO68; VA68; VPP2; Vma1; DEE93; ARCL2D; ATP6A1; IECEE3; ATP6V1A1; ATP6V1A

• Description:
• The antibody against ATP6V1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human ATP6V1A (NP_001681.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ATP6V1A (NP_001681.2).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ATP6V1A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSD

• Gene ID:
• 523

• Uniprot-ID:
• P38606

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain