Rabbit anti-Human ATP1A4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05181P

• Product Name:
• Rabbit anti-Human ATP1A4 Polyclonal Antibody

• Synonym:
• ATP1A1; ATP1AL2; ATP1A4

• Description:
• The antibody against ATP1A4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human ATP1A4 (NP_653300.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human ATP1A4 (NP_653300.2).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ATP1A4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MGLWGKKGTVAPHDQSPRRRPKKGLIKKKMVKREKQKRNMEELKKEVVMDDHKLTLEELSTKYSVDLTKGHSHQRAKEILTRGGPNTVTP

• Gene ID:
• 480

• Uniprot-ID:
• Q13733

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse testis, Mouse brain, Mouse kidney, Rat testis, Rat brain, Rat kidney