Rabbit anti-Human ATG9A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10766P

• Product Name:
• Rabbit anti-Human ATG9A Polyclonal Antibody

• Synonym:
• mATG9; APG9L1; MGD3208; ATG9A

• Description:
• The antibody against ATG9A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human ATG9A (NP_076990.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 700-800 of human ATG9A (NP_076990.4).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ATG9A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EYASTEMSLHALYMHQLHKQQAQAEPERHVWHRRESDESGESAPDEGGEGARAPQSIPRSASYPCAAPRPGAPETTALHGGFQRRYGGITDPGTVPRVPSH

• Gene ID:
• 79065

• Uniprot-ID:
• Q7Z3C6

• Purification Method:
• Affinity purification

• Positive Samples:
• U-251MG