Rabbit anti-Human ATG16L1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07851P

• Product Name:
• Rabbit anti-Human ATG16L1 Polyclonal Antibody

• Synonym:
• IBD10; WDR30; APG16L; ATG16A; ATG16L; ATG16L1

• Description:
• The antibody against ATG16L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-300 of human ATG16L1 (NP_110430.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 60-300 of human ATG16L1 (NP_110430.5).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ATG16L1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDT

• Gene ID:
• 55054

• Uniprot-ID:
• Q676U5

• Purification Method:
• Affinity purification

• Positive Samples:
• Jurkat, Mouse thymus, Rat thymus