Rabbit anti-Human Aromatase (CYP19A1) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12638P

• Product Name:
• Rabbit anti-Human Aromatase (CYP19A1) Polyclonal Antibody

• Synonym:
• ARO; ARO1; CPV1; CYAR; CYP19; CYPXIX; P-450AROM; Aromatase (CYP19A1)

• Description:
• The antibody against Aromatase (CYP19A1) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human Aromatase (CYP19A1) (NP_000094.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human Aromatase (CYP19A1) (NP_000094.2).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Aromatase (CYP19A1)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN

• Gene ID:
• 1588

• Uniprot-ID:
• P11511

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Rat brain