Rabbit anti-Human ARID1A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07347P

• Product Name:
• Rabbit anti-Human ARID1A Polyclonal Antibody

• Synonym:
• ELD; B120; CSS2; OSA1; P270; hELD; BM029; MRD14; hOSA1; BAF250; C1orf4; BAF250a; SMARCF1; ARID1A

• Description:
• The antibody against ARID1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2195-2285 of human ARID1A (NP_006006.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 2195-2285 of human ARID1A (NP_006006.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ARID1A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS

• Gene ID:
• 8289

• Uniprot-ID:
• O14497

• Purification Method:
• Affinity purification

• Positive Samples:
• C2C12