Rabbit anti-Human Argonaute-2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08297P

• Product Name:
• Rabbit anti-Human Argonaute-2 Polyclonal Antibody

• Synonym:
• PPD; Q10; CASC7; EIF2C2; LESKRES; LINC00980; Argonaute-2

• Description:
• The antibody against Argonaute-2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 60-160 of human Argonaute-2 (NP_036286.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 60-160 of human Argonaute-2 (NP_036286.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Argonaute-2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQ

• Gene ID:
• 27161

• Uniprot-ID:
• Q9UKV8

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, HeLa, C6