Rabbit anti-Human Apolipoprotein C3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11439P

• Product Name:
• Rabbit anti-Human Apolipoprotein C3 Polyclonal Antibody

• Synonym:
• Apo-C3; ApoC-3; APOCIII; Apolipoprotein C3

• Description:
• The antibody against Apolipoprotein C3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-99 of human Apolipoprotein C3 (NP_000031.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-99 of human Apolipoprotein C3 (NP_000031.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Apolipoprotein C3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

• Gene ID:
• 345

• Uniprot-ID:
• P02656

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, HL-60, Mouse liver, Mouse small intestine, Rat liver, Rat small intestine