Rabbit anti-Human ApoE Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02351P

• Product Name:
• Rabbit anti-Human ApoE Polyclonal Antibody

• Synonym:
• AD2; LPG; APO-E; ApoE4; LDLCQ5; ApoE

• Description:
• The antibody against ApoE was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 190-304 of human ApoE (NP_000032.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 190-304 of human ApoE (NP_000032.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ApoE

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAA

• Gene ID:
• 348

• Uniprot-ID:
• P02649

• Purification Method:
• Affinity purification

• Positive Samples:
• LO2, A-549, SKOV3, 293T, Mouse brain, Mouse liver, Rat liver, Rat ovary