Rabbit anti-Human APOA1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11432P

• Product Name:
• Rabbit anti-Human APOA1 Polyclonal Antibody

• Synonym:
• HPALP2; apo(a); APOA1

• Description:
• The antibody against APOA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-267 of human APOA1 (NP_000030.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 25-267 of human APOA1 (NP_000030.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• APOA1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

• Gene ID:
• 335

• Uniprot-ID:
• P02647

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse lung, mouse liver, mouse small intestine, rat lung, rat liver