Rabbit anti-Human APBA1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07328P

• Product Name:
• Rabbit anti-Human APBA1 Polyclonal Antibody

• Synonym:
• X11; X11A; LIN10; MINT1; D9S411E; X11ALPHA; APBA1

• Description:
• The antibody against APBA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-390 of human APBA1 (NP_001154.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 240-390 of human APBA1 (NP_001154.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• APBA1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQDLERPPTPAGGRPDSPGLQAPAGQQRAVGPAGGGEAGQRYSKEKRDAISLAIKDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRD

• Gene ID:
• 320

• Uniprot-ID:
• Q02410

• Purification Method:
• Affinity purification