Rabbit anti-Human AP1M2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01511P

• Product Name:
• Rabbit anti-Human AP1M2 Polyclonal Antibody

• Synonym:
• mu2; MU1B; MU-1B; HSMU1B; AP1-mu2; AP1M2

• Description:
• The antibody against AP1M2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 164-423 of human AP1M2 (NP_005489.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 164-423 of human AP1M2 (NP_005489.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• AP1M2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVLFELTGRSKNKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIESVIEKFSHSRVEIMVKAKGQFKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPERNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS

• Gene ID:
• 10053

• Uniprot-ID:
• Q9Y6Q5

• Purification Method:
• Affinity purification

• Positive Samples:
• 22Rv1, BT-474, HepG2, Mouse kidney, Mouse lung, Mouse small intestine