Rabbit anti-Human ANP32A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03678P

• Product Name:
• Rabbit anti-Human ANP32A Polyclonal Antibody

• Synonym:
• LANP; MAPM; PP32; HPPCn; PHAP1; PHAPI; I1PP2A; C15orf1; ANP32A

• Description:
• The antibody against ANP32A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ANP32A (NP_006296.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ANP32A (NP_006296.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ANP32A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE

• Gene ID:
• 8125

• Uniprot-ID:
• P39687

• Purification Method:
• Affinity purification

• Positive Samples:
• A549, HeLa, 293T, Rat thymus