Rabbit anti-Human ALPK1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00352P

• Product Name:
• Rabbit anti-Human ALPK1 Polyclonal Antibody

• Synonym:
• LAK; ROSAH; 8430410J10Rik; ALPK1

• Description:
• The antibody against ALPK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 340-500 of human ALPK1 (NP_001095876.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 340-500 of human ALPK1 (NP_001095876.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ALPK1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RDDEPVTGKQELHSFVKAAFGLTTVHRRLHGETGTVHAASQLCKEAMGKLYNFSTSSRSQDREALSQEVMSVIAQVKEHLQVQSFSNVDDRSYVPESFECRLDKLILHGQGDFQKILDTYSQHHTSVCEVFESDCGNNKNEQKDAKTGVCITALKTEIKNI

• Gene ID:
• 80216

• Uniprot-ID:
• Q96QP1

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, SW620