Rabbit anti-Human alpha 1 Spectrin Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11010P

• Product Name:
• Rabbit anti-Human alpha 1 Spectrin Polyclonal Antibody

• Synonym:
• EL2; HPP; HS3; SPH3; SPTA; alpha 1 Spectrin

• Description:
• The antibody against alpha 1 Spectrin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 940-1160 of human alpha 1 Spectrin (NP_003117.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 940-1160 of human alpha 1 Spectrin (NP_003117.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• alpha 1 Spectrin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KHEAFLLDLNSFGDSMKALRNQANACQQQQAAPVEGVAGEQRVMALYDFQARSPREVTMKKGDVLTLLSSINKDWWKVEAADHQGIVPAVYVRRLAHDEFPMLPQRRREEPGNITQRQEQIENQYRSLLDRAEERRRRLLQRYNEFLLAYEAGDMLEWIQEKKAENTGVELDDVWELQKKFDEFQKDLNTNEPRLRDINKVADDLLFEGLLTPEGAQIRQE

• Gene ID:
• 6708

• Uniprot-ID:
• P02549

• Purification Method:
• Affinity purification

• Positive Samples:
• 239T, LO2, A-549, Mouse kidney, Mouse liver, Mouse lung, Rat heart