Rabbit anti-Human AIF1/IBA1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12810P

• Product Name:
• Rabbit anti-Human AIF1/IBA1 Polyclonal Antibody

• Synonym:
• IBA1; IRT1; AIF-1; IRT-1; AIF1/IBA1

• Description:
• The antibody against AIF1/IBA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human AIF1/IBA1 (NP_001614.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human AIF1/IBA1 (NP_001614.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• AIF1/IBA1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

• Gene ID:
• 199

• Uniprot-ID:
• P55008

• Purification Method:
• Affinity purification

• Positive Samples:
• THP-1